PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G01140.1
Common NameAtMYB106, MYB106, NOK
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 388aa    MW: 43557.8 Da    PI: 8.5555
Description myb domain protein 106
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G01140.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.9e-1857104148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
      AT3G01140.1  57 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYL 104
                      79********************************************97 PP

2Myb_DNA-binding54.33e-17110155148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
      AT3G01140.1 110 RGKFTVQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 155
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2648107IPR009057Homeodomain-like
PROSITE profilePS5129418.62952104IPR017930Myb domain
SuperFamilySSF466896.24E-3154151IPR009057Homeodomain-like
SMARTSM007171.7E-1456106IPR001005SANT/Myb domain
PfamPF002498.0E-1757104IPR001005SANT/Myb domain
CDDcd001671.63E-1159104No hitNo description
PROSITE profilePS5129426.753105159IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-26108160IPR009057Homeodomain-like
SMARTSM007172.6E-17109157IPR001005SANT/Myb domain
PfamPF002491.7E-16110155IPR001005SANT/Myb domain
CDDcd001679.33E-12112155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MPIHVRDREK GRLQNLNRDI FCCVSPSIYQ SDAKRAAFVI ILIMIISPCC DKAGLKKGPW  60
TPEEDQKLLA YIEEHGHGSW RSLPEKAGLQ RCGKSCRLRW TNYLRPDIKR GKFTVQEEQT  120
IIQLHALLGN RWSAIATHLP KRTDNEIKNY WNTHLKKRLI KMGIDPVTHK HKNETLSSST  180
GQSKNAATLS HMAQWESARL EAEARLARES KLLHLQHYQN NNNLNKSAAP QQHCFTQKTS  240
TNWTKPNQGN GDQQLESPTS TVTFSENLLM PLGIPTDSSR NRNNNNNESS AMIELAVSSS  300
TSSDVSLVKE HEHDWIRQIN CGSGGIGEGF TSLLIGDSVG RGLPTGKNEA TAGVGNESEY  360
NYYEDNKNYW NSILNLVDSS PSDSATMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26551595108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.696630.0floral meristem| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO793865650.0
Genevisible259281_at0.0
Expression AtlasAT3G01140-
AtGenExpressAT3G01140-
ATTED-IIAT3G01140-
Functional Description ? help Back to Top
Source Description
TAIREncodes a MIXTA-like MYB gene NOECK (NOK). Loss of function mutations show an increased number of branchpoints in leaf trichomes suggesting a role in negative regulation of trichome branching.
Function -- GeneRIF ? help Back to Top
  1. combination of transcript profiling and map-based cloning revealed that the NOECK gene of Arabidopsis encodes AtMYB106, a MIXTA-like transcription factor and homolog of cotton GhMYB25
    [PMID: 18805951]
  2. roles in both promoting and limiting trichome development
    [PMID: 21070410]
  3. Data indicate that the MIXTA-like MYB transcription factors MYB106 and MYB16, which regulate epidermal cell morphology, also regulate cuticle development coordinately with WIN1/SHN1.
    [PMID: 23709630]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G01140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G01510(R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G01140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493090.0AF249309.1 Arabidopsis thaliana putative transcription factor (MYB106) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186763.20.0myb domain protein 106
TrEMBLF4J2A80.0F4J2A8_ARATH; Myb domain protein 106
STRINGAT3G01140.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Luo D,Oppenheimer DG
    Genetic control of trichome branch number in Arabidopsis: the roles of the FURCA loci.
    Development, 1999. 126(24): p. 5547-57
    [PMID:10572032]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  7. Baumann K, et al.
    Control of cell and petal morphogenesis by R2R3 MYB transcription factors.
    Development, 2007. 134(9): p. 1691-701
    [PMID:17376813]
  8. Servet C, et al.
    Characterization of a phosphatase 2C protein as an interacting partner of the histone acetyltransferase GCN5 in Arabidopsis.
    Biochim. Biophys. Acta, 2008 Jun-Jul. 1779(6-7): p. 376-82
    [PMID:18498779]
  9. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  10. Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
    Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
    Mol Plant, 2009. 2(4): p. 803-22
    [PMID:19626137]
  11. Plett JM,Mathur J,Regan S
    Ethylene receptor ETR2 controls trichome branching by regulating microtubule assembly in Arabidopsis thaliana.
    J. Exp. Bot., 2009. 60(13): p. 3923-33
    [PMID:19648171]
  12. Plett JM,Wilkins O,Campbell MM,Ralph SG,Regan S
    Endogenous overexpression of Populus MYB186 increases trichome density, improves insect pest resistance, and impacts plant growth.
    Plant J., 2010. 64(3): p. 419-32
    [PMID:20807210]
  13. Gilding EK,Marks MD
    Analysis of purified glabra3-shapeshifter trichomes reveals a role for NOECK in regulating early trichome morphogenic events.
    Plant J., 2010. 64(2): p. 304-17
    [PMID:21070410]
  14. Oshima Y, et al.
    MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.
    Plant Cell, 2013. 25(5): p. 1609-24
    [PMID:23709630]
  15. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  16. Folkers U,Berger J,H
    Cell morphogenesis of trichomes in Arabidopsis: differential control of primary and secondary branching by branch initiation regulators and cell growth.
    Development, 1997. 124(19): p. 3779-86
    [PMID:9367433]